Entry information : AlyAPx[P]01-3
Entry ID 7526
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2010-08-11 (Christophe Dunand)
Peroxidase information: AlyAPx[P]01-3
Name AlyAPx[P]01-3
Class Ascorbate peroxidase     [Orthogroup: APx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyAPx[P]01-3
start..stop
S start..stop
AhalAPx02 229 8.85e-78 1..126 41..165
AlyAPx01 228 1.99e-77 1..126 41..165
AtAPx01 227 3.92e-77 1..126 41..165
TparAPx01 223 1.15e-75 1..126 41..165
Gene structure Fichier Exons


exon

Literature and cross-references AlyAPx[P]01-3
DNA ref. Phytozome 12:   scaffold_4 (13741262..13741867)
Protein sequence: AlyAPx[P]01-3
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   124
PWM (Da):   %s   13245.51  
PI (pH):   %s   5.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
WHSAGTSxCQSRTGGPFGTMRFDAEQAHGANSGIHIALRLFDPIREQFPTISFAG*FEQLAEVVAVEVTGGPEIPFYPGREDKPQPPPEGRLPDATKTFDH*RDVFAKQMGFSDKDIVAL
SGAHTL

Retrieve as FASTA  
Remarks Pseudogene. Sequence from genomic (chromo 4).
DNA
Send to BLAST
CDS
Send to BLAST