1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx125 (Glyma03g01020.1)
Entry ID 8945
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-23 (Christophe Dunand)
Peroxidase information: GmPrx125 (Glyma03g01020.1)
Name (synonym) GmPrx125 (Glyma03g01020.1)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx125
start..stop		 S start..stop
PvPrx13 495 8.47e-179 3..313 4..315
MtPrx89 465 4.82e-167 13..311 13..313
GmPrx[P]125 421 8.16e-151 70..312 1..243
MtPrx[P]116 408 2.47e-144 5..311 2..308
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx125 (Glyma03g01020.1)
DNA ref. Phytozome 12:   Gm03 (752372..749995)
Protein sequence: GmPrx125 (Glyma03g01020.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312 (294)
PWM (Da):   %s   33612.21 (31312.9) Transmb domain:   %s   i5-27o
PI (pH):   %s   8.2 (7.31) Peptide Signal:   %s   cut: 19 range:19-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKIKILYFYFILLPLAFADLKVGFYASSCPKAESIVKKVVQNRFNRDKSITAALLRMHFHDCAVRGCDASILINSTKANTAEKEAGANGSVRGYDLIDEAKKTLEAACPSTVSCADIITL
ATRDAVALSGGPQYDVPTGRRDGLVSNIDDVNIPGPNTPVSVTSQFFASKGITTQEMVTLFGAHTVGVAHCSFFDGRLSGAKPDPTMDPALNAKLVKLCSSRGDPATPLDQKSSFVFDNE
FYEQILAKKGVLLIDQQLALDATTKGFVSDFAANGDKFQKGFANAIVKMGEIDVLVGNQGEIRRKCSVFNRN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA ►
Send to BLAST
CDS►
Send to BLAST