1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx188 (Glyma09g41450.1)
Entry ID 8977
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-26 (Christophe Dunand)
Peroxidase information: GmPrx188 (Glyma09g41450.1)
Name (synonym) GmPrx188 (Glyma09g41450.1)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx188
start..stop		 S start..stop
GmPrx52 624 0 1..317 1..317
LjPrx10 537 0 1..316 1..316
AhPrx04 519 0 1..316 1..316
GrPrx38 508 0 4..317 8..324
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx188 (Glyma09g41450.1)
DNA ref. Phytozome 12:   Gm09 (46123325..46120487)
Protein sequence: GmPrx188 (Glyma09g41450.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   33375.51 (30773.0)  
PI (pH):   %s   7.93 (7.31) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MILPNIKVRFFLLFCLIGIVSAQLSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTSSFTGEKTAGPNAGSIRGFDVIDTIKSKVESLCPGVVSCA
DILAVAARDSVVALGGTTWTVQLGRRDSTTASLSSANSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFRTRIYNDTNIDSSFAKSLQGNCPSTGGDSNLAPLDTTSP
NTFDNAYFKNLQSKKGLLHSDQELFNGGSTDSQVNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) . Incorrect prediction from phytozome (Extra short sequence at 5' end).
DNA ►
Send to BLAST
CDS►
Send to BLAST