1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx[P]219 (Glyma11g31050.1)
Entry ID 9037
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx[P]219 (Glyma11g31050.1)
Name (synonym) GmPrx[P]219 (Glyma11g31050.1)
Class Class III peroxidase     [Orthogroup: Prx041]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]219
start..stop		 S start..stop
GmPrx105 397 7.33e-141 1..245 77..331
GmPrx[P]43 366 2.26e-130 1..245 1..228
MtPrx90 358 1.42e-125 1..245 77..331
GmPrx[P]313 347 1.67e-122 9..245 1..239
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9037' 'complement(join(32027130..32027551,32027890..32027951,32027988..32028238))' Exons►


exon

Literature and cross-references GmPrx[P]219 (Glyma11g31050.1)
DNA ref. Phytozome 12:   Gm11 (32028238..32027130)
Protein sequence: GmPrx[P]219 (Glyma11g31050.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   244 (303)
PWM (Da):   %s   27848.84 (33303.5) Transmb domain:   %s   i16-38o53-75i102-124o139-161i174-196o216-238i380-402o
PI (pH):   %s   5.01 (5.07) Peptide Signal:   %s   cut: 20 range:20-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LILDNMEGMTSENLVGPNMNSLRGFEVIDKIKYLLEEECPITVSC
ADILAMVAHHVVELVNTALSQGSNECSYIFIFISQVSVERFSDNFKQQGLDIEDLVTLGSHTIGRARCLSFK*REYDAKEEYDYGYDHYKQYPSFRRILQSICPIEGRDNKFAPLDFQTPKRFDNHYFINILEGKGLLDSNNVLINHDLDGKITEQMW
AYASNEKLLFASFAKSMIKMGNINVLTGNEGEIRRNYRFV

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Phytozome (first exon and a sequence in the frame are missing, stop in frame).
DNA ►
Send to BLAST
CDS►
Send to BLAST