1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx[P]250 (Glyma14g38160.1)
Entry ID 9041
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx[P]250 (Glyma14g38160.1)
Name (synonym) GmPrx[P]250 (Glyma14g38160.1)
Class Class III peroxidase     [Orthogroup: Prx012]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]250
start..stop		 S start..stop
GmPrx40 427 1.62e-152 4..241 72..322
MtPrx02 372 6.17e-131 4..242 69..315
MtPrx86 371 1.67e-130 4..242 69..315
MtPrx70 370 4.27e-130 4..242 69..315
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx[P]250 (Glyma14g38160.1)
DNA ref. Phytozome 12:   Gm14 (47389904..47388698)
Protein sequence: GmPrx[P]250 (Glyma14g38160.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   256
PWM (Da):   %s   27758.91 Transmb domain:   %s   i7-29o
PI (pH):   %s   6.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
NVHVQGCDGSVLLDDTPSFSGEKTALPNLNSIRGFEVVNEIKAAVDKACNRPVISCADILAVAARDSVAILGGP*YRYQVLLGRRDARYASKDAANASLPPPFFNFPQLLASFQSHGLVL
SGGHTIGLAKCIIFRDRIFNDTNIDPNFAATLRHFCGGDTNLSPFDASSPSQFDTTYYKALLHKKGLLHSDQELFKVDGGESDRLVQLYTYDPYAFARDFGVSMIKMGNLKPLTGYEGEI
RCTIAEKSTTSTACHEY

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Phytozome (5' end is missing which can't be found and Stop in frame).
DNA ►
Send to BLAST
CDS►
Send to BLAST