1. Browse the Database
  2. View Redoxidase
Entry information : MguPrx14 (mgv1a009407m)
Entry ID 9184
Creation 2011-07-02 (Qiang Li)
Last sequence changes 2011-12-13 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-08 (Qiang Li)
Peroxidase information: MguPrx14 (mgv1a009407m)
Name (synonym) MguPrx14 (mgv1a009407m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx14
start..stop		 S start..stop
MguPrx85 628 0 1..315 1..315
MguPrx43 516 0 1..315 7..318
SaPrx01 485 4e-174 3..315 9..316
SaPrx01_other 471 1.52e-168 3..302 9..304
Gene structure Fichier Exons►


exon

Literature and cross-references MguPrx14 (mgv1a009407m)
DNA ref. Phytozome 12:   scaffold_32 (843578..841413)
Protein sequence: MguPrx14 (mgv1a009407m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (317)
PWM (Da):   %s   37110 (34206.4)  
PI (pH):   %s   8.86 (8.86) Peptide Signal:   %s   cut: 27 range:27-343
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKSFIFSLIGIAILFAITNNIPVSEAQLSATFYNSRCPNAANIIRNSIRRAISRERRMAASLIRLHFHDCFVQGCDASILLDETPSIQSEKTAFPNINSARGYEVIEAAKAEVERACPGV
VSCADVLTLAARDASVAVGGPSWSVRLGRRDSTTASRSQANIDLPSPFVGLDALISAFDIKGLTARDMVALSGAHTLGQAQCFLFRGRIYSNGTDIDANFAKEKRRRCPQTGGDSNLAAL
DLVTPNSFDNNYYRNIVQRKGLLQTDQILLSGSTSAIVTDYSRNPRTFAADFARAMIKMSEIQPLVGQAGIIRRVAAQSTSSFINNSVRCACVHGCLTLDLSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA ►
Send to BLAST
CDS►
Send to BLAST