Entry information : VvAPx05 (GSVIVT01018743001)
Entry ID 9411
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-08 (Qiang Li)
Peroxidase information: VvAPx05 (GSVIVT01018743001)
Name (synonym) VvAPx05 (GSVIVT01018743001)
Class Ascorbate peroxidase     [Orthogroup: APx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Vitaceae Vitis
Organism Vitis vinifera (Grape)    [TaxId: 29760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VvAPx05
start..stop
S start..stop
VvAPx04 291 2.96e-100 1..189 1..204
MtAPx05 231 5.04e-77 17..206 2..206
PotacuAPx01 224 1.19e-73 4..203 14..228
GmAPx06 221 4.34e-73 21..206 6..206
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9411' 'complement(join(20263391..20263445,20263636..20263715,20263808..20263890,20264118..20264193,20264339..20264388,20264693..20264817,20272263..20272414))' Exons


exon

Literature and cross-references VvAPx05 (GSVIVT01018743001)
DNA ref. Phytozome 12:   chr4 (20272414..20263391)
Protein sequence: VvAPx05 (GSVIVT01018743001)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   207
PWM (Da):   %s   22935.51  
PI (pH):   %s   8.13
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEAQASTLASTPAPTPAPLVVNVEYYKEIERAHRYLCAFISNKKCAPMMLxFHDAGTYDALTKTGGPNGSIRNPQELNHSANRGLKTAVDLCEEVKRRHHCITYADLYQLAGVVVVEIIG
GPTIYALWPCLWKRSAEHLRSVFNRMGLEDKDIVALSGAHTLGGARKQVPGFDGKWTEEPWKFDNSYFKRGFNREAGDCLYFPQTKH

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing).
DNA
Send to BLAST
CDS
Send to BLAST