1. Browse the Database
  2. View Redoxidase
Entry information : NhaeGPx01
Entry ID 9834
Creation 2011-11-22 (Passaia Gisèle)
Last sequence changes 2011-12-01 (Christophe Dunand)
Sequence status complete
Reviewer Passaia Gisèle
Last annotation changes 2012-04-24 (Catherine Mathe (Scipio))
Peroxidase information: NhaeGPx01
Name NhaeGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Nectria
Organism Nectria haematococca    [TaxId: 140110 ]
Cellular localisation N/D
Tissue type N/D
Inducer Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value NhaeGPx01
start..stop		 S start..stop
FoGPx01 336 2.61e-118 3..247 4..241
GzGPx 335 6.13e-118 29..247 50..246
GmoGPx01 326 2.82e-114 34..247 40..243
ChigGPx01 314 1.77e-109 30..244 34..240
Gene structure Fichier Exons►


exon

Literature and cross-references NhaeGPx01
Literature Coleman JJ et al. The genome of Nectria haematococca: contribution of supernumerary chromosomes to gene expansion. 2009. PLoS Genet.
DNA ref. JGI genome:   sca_6_chr9_2_0 (1347000..1346183)
Protein sequence: NhaeGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   247 (763)
PWM (Da):   %s   27722.4 (83712.4)  
PI (pH):   %s   9.9 (7.45) Peptide Signal:   %s   cut: 19 range:19-781
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPWRVPESLPLPLPSRRFMRGLNKPTIRTSICSPPLSPLNNNINI
KRAAFFRLGYRKFPSAAAFSTSIPRFLPSSNMASATSFYDFKPLDKRGQEVPLADYKGKVVLIVNTASKCGFTPQYEGLEKLWTDLKQKHPDDFVILGFPCNQFGGQEPGSDEEIQSFCQINYGVSFPIMQKTEVNGDGTNPLWAWLKEQQPGLLGLKRVKWNFE
KFLVGRDGKVKGRWASTTKPESLEKPILEALAEEVK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chro9, 1 intron) 51 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST