Entry information : EcamPrx05 ( EcC012499.10)
Entry ID 10388
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-21 (Christophe Dunand)
Peroxidase information: EcamPrx05 ( EcC012499.10)
Name (synonym) EcamPrx05 ( EcC012499.10)
Class Class III peroxidase     [Orthogroup: Prx046]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx05
start..stop
S start..stop
EgrPrx12 407 1.41e-145 1..198 1..198
EgrPrx05 402 1.2e-143 1..198 1..198
EguPrx12 402 1.4e-143 1..198 1..198
EcamPrx12 397 6.01e-142 5..198 1..194
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10388' 'join(1..246,404..589,749..910)' Exons


exon

Literature and cross-references EcamPrx05 ( EcC012499.10)
Protein sequence: EcamPrx05 ( EcC012499.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   198 (176)
PWM (Da):   %s   21792.12 (19342.9)  
PI (pH):   %s   4.82 (4.67) Peptide Signal:   %s   cut: 23 range:23-198
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASMWWQLLLSMLALVSSCAARRIQAEATIELPPPLQWQFYQNS
CPDAEKYVRDQVEFYWKQDRTLAPKLIRIVYSDCFVK
GCDASVLLDGPDSEKKAPQNAAFLGFTLEVIDKIKEVLEQHCPGVVSCADIINLAARDAVVLAGGTSYPVPTGRRDGNSSTAKSVDLPLQAVPWGSVVPYFQEKGLDVQDLTTLLG

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa (3' end is missing due to NNNNN). containing motif YSDC.
DNA
Send to BLAST
CDS
Send to BLAST