Entry information : GmarCIIBC15
Entry ID 11888
Creation 2013-05-23 (Nizar Fawal)
Last sequence changes 2015-06-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCIIBC15
Name GmarCIIBC15
Class Other class II peroxidase type C    [Orthogroup: CIIBC002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBC15
start..stop
S start..stop
GmarCIIBC16 519 0 1..350 1..345
GmarCIIBC03 511 0 1..349 1..358
GmarCIIBC08 491 9.92e-176 1..349 1..348
GmarCIIBC11 478 7.35e-171 10..350 13..359
Gene structure Fichier Exons


exon

Literature and cross-references GmarCIIBC15
DNA ref. JGI genome:   scaffold_7 (1363313..1361082)
Cluster/Prediction ref. JGI gene:   265964
Protein sequence: GmarCIIBC15
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (329)
PWM (Da):   %s   36487.86 (34392.7) Transmb domain:   %s   i141-163o201-223i
PI (pH):   %s   4.25 (4.20) Peptide Signal:   %s   cut: 21 range:21-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLGRLAVFVALAALQLGNAAIVSKRSVTCPTGQTTANEACCALFPVIDSMQKDLFEGGECGEDAHAALRLAFHDAIGFSTNGRGGGADGSILTFHTTEETYAANAGIDDIVARQMPIFL
QSNLTAGDFVHLAAAIGTGNCPGAPQLSYSIGRPAPAGPAPDGTVPEPTQSVSEILGRFSDAGFFSAEVIWLLASHSIAAANKIDTSIPGTPFDSTPSTFDTQFFLEVLLNGMQFPGSGQ
HTGEVVSPLAGEMRLQSDFAFSQDPQTACFWQEAIDDQTFIMARFRDAMQKLQLLGQSGLTDCSDVIPVPKAFSSHITYPGGFNQTDCTALPFPSIATVSGPAPTIPPV*

Retrieve as FASTA  
Remarks complete sequence from genomics (16 introns). Incorrect prediction from JGI.
DNA
Send to BLAST
CDS
Send to BLAST