1. Browse the Database
  2. View Redoxidase
Entry information : OsGPx04(LOC_Os06g08670)
Entry ID 2870
Creation 2007-08-15 (Christophe Dunand)
Last sequence changes 2007-08-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-02-18 (Catherine )
Peroxidase information: OsGPx04(LOC_Os06g08670)
Name OsGPx04(LOC_Os06g08670)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsGPx04
start..stop		 S start..stop
OruGPx04 462 1.62e-168 1..225 1..225
OsiGPx04 423 5.06e-153 1..225 1..223
TaGPx04-1A 326 1.59e-114 15..225 5..220
ZmGPx04 324 5.79e-114 55..225 49..221
Gene structure Fichier Exons►


exon

Literature and cross-references OsGPx04(LOC_Os06g08670)
Protein ref. GenPept:   BAD72440  BAF18920 UniProtKB:   Q0DE03  Q5SMW6 [Incorrect splicing] UniProtKB_Uniparc:   A3B930 [Incorrect splicing]
DNA ref. GenBank:   NC_008399.1 (4332529..4334725)
Cluster/Prediction ref. UniGene:   Os.7552
Protein sequence: OsGPx04(LOC_Os06g08670)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   232
PWM (Da):   %s   24802.8 Transmb domain:   %s   i7-24o
PI (pH):   %s   10.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTTTTTAAAAARFTCLAPATRPASASASAGRFLLPARQWGAATTHGSAAVPVVAAPSRRWAPGVAYATAATGKSVHDFTVKDIDGKDVALSKFKGRALLIVNVASQCGLTTANYTELS
HLYEKYKTGFEILAFPCNQFGAQEPGSNPQIKQFACTRFKAEFPIFDVDVNGPNTAPIYKFLKSSAGGFLGDLVKWNFEKFLVDKTGKVVERYPPTTSPFQIEVLMVRQP*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 38 ESTs (TC from TGI) and 46 EST (UniGene Os.7552 which compile japonica and indica together). Two TREMBL accessions: Q5SMW6 and A3B930 both contain extra sequences not confirmed by ESTs (splicing prediction error).
Predicted sequence in Phytozome (LOC_Os06g08670) erroneous in C-term (prediction error for the last exon)
DNA ►
Send to BLAST
CDS►
Send to BLAST