1. Browse the Database
  2. View Redoxidase
Entry information : AtPrxII02 (At1g65980 / TPx1 / PRXIIB / PeroxiredoxinIIB / Thioredoxinreductase2B / AtPrxIIB)
Entry ID 4344
Creation 2007-01-31 (Christophe Dunand)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-17 (Christophe Dunand)
Peroxidase information: AtPrxII02 (At1g65980 / TPx1 / PRXIIB / PeroxiredoxinIIB / Thioredoxinreductase2B / AtPrxIIB)
Name (synonym) AtPrxII02 (At1g65980 / TPx1 / PRXIIB / PeroxiredoxinIIB / Thioredoxinreductase2B / AtPrxIIB)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Buds
Inflorescences
Leaves
Mixed tissues
Roots
Seeds
Siliques
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrxII02
start..stop		 S start..stop
AlyPrxII02 324 4.04e-116 1..162 1..162
BrPrxII03_other 321 9.02e-115 1..162 1..162
AtPrxII03 316 5.35e-113 1..162 1..162
AlyPrxII03 315 1.29e-112 1..162 1..162
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrxII02 (At1g65980 / TPx1 / PRXIIB / PeroxiredoxinIIB / Thioredoxinreductase2B / AtPrxIIB)
Literature Verdoucq L., Jacquot J.-P., Vignols F., Chartier Y., Meyer Y. Submitted (JAN-1999)
Protein ref. UniProtKB:   Q9XEX2  Q8L9P7 [Mismatch] UniProtKB_Uniparc:   Q2V4E9 [Fragment]
DNA ref. Phytozome 12:   Chr1 (24560753..24559524)
Cluster/Prediction ref. Phytozome Gene 12:   19649394 UniGene:   At.20543
Omic ref. AtProteome:   At1g65980 ATTED-II:   At1g65980 e-FP Browser:   At1g65980 ePlant:   At1g65980 Genevestigator:   At1g65980 TAIR:   At1g65980
Protein sequence: AtPrxII02 (At1g65980 / TPx1 / PRXIIB / PeroxiredoxinIIB / Thioredoxinreductase2B / AtPrxIIB)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162 (302)
PWM (Da):   %s   17303.9 (32038.0)  
PI (pH):   %s   5 (4.92) Peptide Signal:   %s   cut: 23 range:23-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIAVGDVVPDGTISFFDENDQLQTASVHSLAAGKKVILFGVPG
AFTPTCSMKHVPGFIEKAEELKSKGVDEIICFVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGLGVRSRRFALLLDDLKVTVANVESGGEFTVSSADDILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 2 introns), 9 cDNA and 144 ESTs. Three TREMBL accessions Q9XEX2, Q8L9P7 (one mRNA included in the UniGene and 7 mismatches) and Q2V4E9 (fragment).
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST