1. Browse the Database
  2. View Redoxidase
Entry information : AlyPrxII02 (AlyPrxIIB)
Entry ID 7473
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrxII02 (AlyPrxIIB)
Name (synonym) AlyPrxII02 (AlyPrxIIB)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrxII02
start..stop		 S start..stop
AtPrxII02 324 4.04e-116 1..162 1..162
BrPrxII03_other 319 2.73e-114 1..162 1..162
AtPrxII03 318 7.5e-114 1..162 1..162
AlyPrxII03 317 2.18e-113 1..162 1..162
Gene structure Fichier Exons►


exon

Literature and cross-references AlyPrxII02 (AlyPrxIIB)
DNA ref. Phytozome 12:   scaffold_2 (10565712..10564417)
Protein sequence: AlyPrxII02 (AlyPrxIIB)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17318.91  
PI (pH):   %s   5.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPITVGDVVPDGTISFFDENDQLQTASVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFIEKAEELKSKGVDDIICFVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDK
GLGVRSRRFALLLDNLKVTVANVESGGEFTVSSADDILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 2 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST