Entry information : GmPrx12 ( Glyma13g38310)
Entry ID 477
Creation 2006-07-20 (Christophe Dunand)
Last sequence changes 2013-12-22 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-08 (Achraf Jemmat)
Peroxidase information: GmPrx12 ( Glyma13g38310)
Name (synonym) GmPrx12 ( Glyma13g38310)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Roots
Seedling epicotyls
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx12
start..stop
S start..stop
GmPrx86 656 0 1..324 3..326
GmPrx11 642 0 1..324 3..326
GmPrx55 638 0 1..325 3..327
LjPrx13 567 0 3..324 7..327
Gene structure Fichier Exons


exon

Literature and cross-references GmPrx12 ( Glyma13g38310)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm13 (39120674..39118913)
Protein sequence: GmPrx12 ( Glyma13g38310)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (303)
PWM (Da):   %s   35315.06 (33015.8)  
PI (pH):   %s   7.76 (7.50) Peptide Signal:   %s   cut: 22 range:22-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSNLRFLSLCLLALIASTHAQLQLGFYANSCPKAEQIVLKFVHDHIHNAPSLAAALIRMHFHDCFVRGCDASVLLNSTTNQAEKNAPPNLTVRGFDFIDRIKSLVEAECPGVVSCADIL
TLAARDTIVATGGPFWKVPTGRRDGVVSNLTEARNNIPAPSSNFTTLQTLFANQGLDLKDLVLLSGAHTIGIAHCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFKCTDLNKLNTTKIE
MDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIQLLEGSVENFFAEFATSIEKMGRINVKTGTEGEIRKHCAFINS*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 27 ESTs. No prediction from phytozome.
DNA
Send to BLAST
CDS
Send to BLAST