Entry information : MtAPx-R ( Medtr3g107060.1[4.0] / Medtr3g107060.1[3.5])
Entry ID 5198
Creation 2007-08-22 (Christophe Dunand)
Last sequence changes 2016-04-07 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: MtAPx-R ( Medtr3g107060.1[4.0] / Medtr3g107060.1[3.5])
Name (synonym) MtAPx-R ( Medtr3g107060.1[4.0] / Medtr3g107060.1[3.5])
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Cell culture
Leaves
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtAPx-R
start..stop
S start..stop
LjAPx-R 493 1.03e-177 11..320 12..317
GmAPx-R 476 4.5e-171 11..320 9..319
PtAPx-R 426 4.98e-151 18..320 27..337
VvAPx-R 421 2.49e-149 17..321 21..331
Gene structure Fichier Exons


exon

Literature and cross-references MtAPx-R ( Medtr3g107060.1[4.0] / Medtr3g107060.1[3.5])
Literature Torres-Jerez,I., Scott,A.D., Harris,A.R., Gonzales,R.A., Bell,C.J., Flores,H.R., Inman,J.T., Weller,J.W. and May,G.D. Expressed Sequence Tags from the Samuel Roberts Noble Foundation - Center for Medicago Genomics Research Unpublished (2000)
Protein ref. UniProtKB:   G7JB12
DNA ref. Phytozome 12:   chr3 (49465112..49469798)
Cluster/Prediction ref. Phytozome Gene 12:   31054696 UniGene:   Mtr.10760
Omic ref. Gene atlas:   Mtr.10201.1.S1_at
Protein sequence: MtAPx-R ( Medtr3g107060.1[4.0] / Medtr3g107060.1[3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320
PWM (Da):   %s   34722.63 Transmb domain:   %s   o4-26i
PI (pH):   %s   8.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMCSRVSNRIVRCASGGENSYPAKLQPSCLSTVKFRSNKPNDHASSDVSSSSRRAVIFSSIATLPCLLPLTHIFGSLQANAMPPGTKEYLLIKEELRKVLTKGKAAGVLRLVFHDAGTFE
IDDNTGGMNGSIVYELERPENTGLKKSVKVLQKAKTQIDAIHPVSWADVIAVAGTEAVEVCGGPTITVSLGRQDSPGPDPEGKLPEETLDASGLKRCFHKKGFSTQELVALSGAHTLGSK
GFGSPTSFDNSYYKVLLEKPWTPSGGMSTMIGLPSDHALVEDDECLRWIKKYAENENMFFEDFKNVYVKLVNSGVKWNSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 9 introns) and 4 ESTs (two independant TGI both with frame shift: CA989447 + TC105875).
DNA
Send to BLAST
CDS
Send to BLAST