1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx58 (Glyma09g02680.1)
Entry ID 557
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx58 (Glyma09g02680.1)
Name (synonym) GmPrx58 (Glyma09g02680.1)
Class Class III peroxidase    [Orthogroup: Prx048]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx58
start..stop		 S start..stop
GmPrx57 670 0 1..350 1..351
GmPrx08 545 0 1..349 1..355
GmPrx85 543 0 23..350 26..355
MtPrx17 523 0 1..349 1..355
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx58 (Glyma09g02680.1)
Literature Public Soybean EST.
DNA ref. Phytozome 12:   Gm09 (1822925..1825316)
Protein sequence: GmPrx58 (Glyma09g02680.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (325)
PWM (Da):   %s   37990.55 (35448.1) Transmb domain:   %s   i5-22o
PI (pH):   %s   7.34 (6.98) Peptide Signal:   %s   cut: 25 range:25-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRCFGLVVIGLVVVLGGLPFSSNAGLDPFFYKKSCPQVHFIVFRVVEKVSRTDTRMPASLVRLFFHDCFVQGCDASILLNNTATIVSEQQALPNNNSIRGLDVVNEIKTELEQVCPGVVS
CADILTLAAEVSSVLAHGPFLKFPLGRRDSLTANRTLANENLPAPFFNLTQLKAAFAVQGLDTTDLVALSGAHSFGRAHCFFILDRLYNFSGTGRPDPTLDTTYLQQLRQICPQGGPNNL
LNFDPTTPDTLDKNYYSNLKVKKGLLQSDQELFSTPGADTISIVNKFSSDQIAFFKSFSASMIKMGNIGVLTGKKGEIRKQCNFVNKKSAELDIGIVASESEEGVVSSI*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST