Entry information : PtGPx[P]01 (POPTR_0018s02710)
Entry ID 5739
Creation 2007-08-16 (Christophe Dunand)
Last sequence changes 2010-08-02 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtGPx[P]01 (POPTR_0018s02710)
Name (synonym) PtGPx[P]01 (POPTR_0018s02710)
Class Plant glutathione peroxidase     [Orthogroup: Gpx2001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtGPx[P]01
start..stop
S start..stop
PtGPx01 338 2.26e-119 1..230 1..223
LuGPx140 306 1.57e-106 2..230 3..235
LuGPx19 302 1.33e-103 2..235 3..240
CsGPx01 297 1e-102 3..230 5..236
Gene structure Fichier Exons


exon

Literature and cross-references PtGPx[P]01 (POPTR_0018s02710)
DNA ref. Phytozome 12:   scaffold_18 (2426439..2428739)
Protein sequence: PtGPx[P]01 (POPTR_0018s02710)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   240
PWM (Da):   %s   25977.47  
PI (pH):   %s   10.01
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLTFSATFPSLSLPGVNIQSNKTSPTMASFVSAIKSSPVSSKSAFLQHGFSLQSPNLPGFASKAPSLGVFARATTEKSVMIYSTQDIDGKDVPLSKFKGKVLLIVIVASKSGFASTNY
SELTHLYEKYKTEGGFEILAFPCNQFGGQEPGSNPEIKQFACARYKAEFPIFDKVGVNGPSTAPVYQFLKSSAGGFLGGLIKWNLEKFLVDKNRKVVERYPLPTSPFQIKLHFLFCFQAF

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 18, 4 introns). No EST. Last exon is missing (after FQI) => pseudogen. Incorrect prediction from Phytozome.
DNA
Send to BLAST