1. Browse the Database
  2. View Redoxidase
Entry information : SmGPx02-1_0 (SmGPx02a_0)
Entry ID 7403
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-23 (Christophe Dunand)
Peroxidase information: SmGPx02-1_0 (SmGPx02a_0)
Name (synonym) SmGPx02-1_0 (SmGPx02a_0)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmGPx02-1_0
start..stop		 S start..stop
SmGPx02-2_57 336 1.05e-120 1..166 1..166
AcvGPx06-2 261 5.84e-91 3..166 2..165
GgGPx06 256 3.81e-89 2..166 3..166
MtGPx06 254 3.3e-87 1..166 67..231
Gene structure Fichier Exons►


exon

Literature and cross-references SmGPx02-1_0 (SmGPx02a_0)
DNA ref. Phytozome 12:   scaffold_0 (6625331..6626109)
mRNA ref. JGI transcript:   75178 [Incorrect prediction]
Protein sequence: SmGPx02-1_0 (SmGPx02a_0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   18257.22  
PI (pH):   %s   6.61
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSDKPSSIYDITVNDATGNDVSLGSYKDKVLLIVNVASQCGFTTTNYKELNELYEKYKDGFEILAFPCNQFAGQEPGSNEEIQQTVCTRFKAEFPVFGVNVNGADTAPVFKYLKSAKG
GGIFGDFIKWNFSKFLVSKTGEVVERYAPTTNPSKIEKDILKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). No EST. Incorrect prediction from JGI
DNA ►
Send to BLAST
CDS►
Send to BLAST