1. Browse the Database
  2. View Redoxidase
Entry information : AbPrxQ_bisporus
Entry ID 7601
Creation 2010-08-17 (Christophe Dunand)
Last sequence changes 2010-08-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-10 (Christophe Dunand)
Peroxidase information: AbPrxQ_bisporus
Name AbPrxQ_bisporus
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Agaricaceae Agaricus
Organism Agaricus bisporus    [TaxId: 5341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AbPrxQ_bisporus
start..stop		 S start..stop
LbiPrxQ02 275 3.1e-94 22..244 15..224
PplPrxQ02 263 1.81e-89 10..249 2..230
AthiPrxQ 257 5.87e-87 23..244 17..244
AmusPrxQ 256 3.05e-86 2..243 3..246
Gene structure Fichier Exons►


exon

Literature and cross-references AbPrxQ_bisporus
DNA ref. JGI genome:   scaffold_12 (841721..840736)
Cluster/Prediction ref. JGI gene:   195437
Protein sequence: AbPrxQ_bisporus
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   249 (640)
PWM (Da):   %s   25937.17 (70935.2) Transmb domain:   %s   i13-32o
PI (pH):   %s   5.53 (8.52) Peptide Signal:   %s   cut: 35 range:35-674
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPRKAAAATTGEEGMDAEQAAPRRSTRIAAQPRTEDDKPAPKPRA
TKKRTAGDAGASEDGGEGGEDKGKAKKAKGDTTPDDNGTEGSGEDSSATAPVLATIDIGGTLPNLTLKNEKDEDIQVADIASEKGAVVFLVPKADTPGCTTQACGFRDIFDEFAAVNYSVYCLSADSPGAQTKWQSKKELPYSLISD
PKRILITALGAGEGGKTKRSHFIFEKGGKLLEKKIPVKPGSPNLALEFIKSTTASS

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST