1. Browse the Database
  2. View Redoxidase
Entry information : Ggo1CysPrx01
Entry ID 7643
Creation 2010-10-21 (Myriam Duval)
Last sequence changes 2010-10-21 (Myriam Duval)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-10-26 (Christophe Dunand)
Peroxidase information: Ggo1CysPrx01
Name Ggo1CysPrx01
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Gorilla
Organism Gorilla gorilla    [TaxId: 9593 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ggo1CysPrx01
start..stop		 S start..stop
Ptro1CysPrx01-2 456 3.32e-166 1..224 1..224
Ptro1CysPrx01 456 3.32e-166 1..224 1..224
Pabe1CysPrx01 456 3.32e-166 1..224 1..224
Hs1CysPrx01 456 3.32e-166 1..224 1..224
Gene structure Fichier Exons►


exon

Literature and cross-references Ggo1CysPrx01
DNA ref. GenBank:   CABD02023134.1 (2365..6723) [5' end]  CABD02023135.1 (1..4065) [3' end]
Protein sequence: Ggo1CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224 (573)
PWM (Da):   %s   24922.14 (61441.8)  
PI (pH):   %s   6.29 (4.98) Peptide Signal:   %s   cut: 19 range:19-591
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPA
EKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 4 introns)
The 3 last exons are on another contig : not the true places.
DNA ►
Send to BLAST
CDS►
Send to BLAST