Entry information : WcoCIIBA
Entry ID | 8494 |
---|---|
Creation | 2011-09-14 (Christophe Dunand) |
Last sequence changes | 2011-09-14 (Christophe Dunand) |
Sequence status | complete |
Reviewer | Christophe Dunand |
Last annotation changes | 2015-06-29 (Christophe Dunand) |
Peroxidase information: WcoCIIBA
Name | WcoCIIBA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Class | Other class II peroxidase type A [Orthogroup: CIIBA001] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Taxonomy | Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Wolfiporia | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism | Wolfiporia cocos [TaxId: 81056 ] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Cellular localisation | N/D |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Tissue type | N/D |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Inducer | N/D |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Repressor | N/D |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Best BLASTp hits |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8494' 'join(1758239..1758281,1758334..1758362,1758424..1758441,1758496..1758521,1758581..1758685,1758742..1758755,1758810..1758851,1758911..1758989,1759040..1759334,1759392..1759536,1759592..1759758,1759812..1759838)' |
Exons►
|
Literature and cross-references WcoCIIBA
DNA ref. | JGI genome: scaffold_3 (1758239..1759838) |
---|
Protein sequence: WcoCIIBA
Sequence Properties first value : protein second value (mature protein) |
|
||||||||||||
Sequence Send to BLAST Send to Peroxiscan |
|
||||||||||||
Remarks | Complete sequence from genomic (11 introns). No EST. 5'end looks different without concerved residues. alternative prediction MRQGGVAAQAICQSAGRLHRLASRKLMCDEGLLSCIEPPCCI which need to be confirmed. |
||||||||||||
DNA ► Send to BLAST |
|
||||||||||||
CDS► Send to BLAST |
|