Entry information : WcoCIIBA
| Entry ID | 8494 |
|---|---|
| Creation | 2011-09-14 (Christophe Dunand) |
| Last sequence changes | 2011-09-14 (Christophe Dunand) |
| Sequence status | complete |
| Reviewer | Christophe Dunand |
| Last annotation changes | 2015-06-29 (Christophe Dunand) |
Peroxidase information: WcoCIIBA
| Name | WcoCIIBA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Class | Other class II peroxidase type A [Orthogroup: CIIBA001] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Taxonomy | Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Wolfiporia | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Organism | Wolfiporia cocos [TaxId: 81056 ] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Cellular localisation | N/D |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Tissue type | N/D |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Inducer | N/D |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repressor | N/D |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Best BLASTp hits |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene structure Fichier |
Exons►
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Literature and cross-references WcoCIIBA
| DNA ref. | JGI genome: scaffold_3 (1758239..1759838) |
|---|
Protein sequence: WcoCIIBA
| Sequence Properties first value : protein second value (mature protein) |
|
||||||||||||
| Sequence Send to BLAST Send to Peroxiscan |
|
||||||||||||
| Remarks | Complete sequence from genomic (11 introns). No EST. 5'end looks different without concerved residues. alternative prediction MRQGGVAAQAICQSAGRLHRLASRKLMCDEGLLSCIEPPCCI which need to be confirmed. |
||||||||||||
| DNA ► Send to BLAST |
|
||||||||||||
| CDS► Send to BLAST |
|
||||||||||||
