1. Browse the Database
  2. View Redoxidase
Entry information : ZmAPx05(Zm00001d047757 / GRMZM2G054300 [6a] / APx1)
Entry ID 995
Creation 2008-10-03 (Christophe Dunand)
Last sequence changes 2008-10-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2022-12-30 (Christophe Dunand)
Peroxidase information: ZmAPx05(Zm00001d047757 / GRMZM2G054300 [6a] / APx1)
Name ZmAPx05(Zm00001d047757 / GRMZM2G054300 [6a] / APx1)
Class Ascorbate peroxidase    [Orthogroup: APx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Leaves
Inducer Bacterium infection
Repressor N/D
Best BLASTp hits
Perox score E-value ZmAPx05
start..stop		 S start..stop
ZmAPx01 499 0 1..250 1..250
SbAPx01 494 1.72e-180 1..250 1..250
SiAPx01 487 1.21e-177 1..250 1..250
PamAPx01 483 2.57e-176 1..250 1..250
Gene structure Fichier Exons►


exon

Literature and cross-references ZmAPx05(Zm00001d047757 / GRMZM2G054300 [6a] / APx1)
Literature REFERENCE 1 Bai,J. et al., Comparison of pathogen induced defense gene profiles on maize lines with different resistance genes. Unpublished (2003).
REFERENCE 2 Lai,J., Dey,N., Kim,C.S., Bharti,A.K., Rudd,S., Mayer,K.F., Larkins,B.A., Becraft,P. and Messing,J. Characterization of the maize endosperm transcriptome and its comparison to the rice genome. Genome Res. 14 (10A), 1932-1937 (2004).
REFERENCE 3 Wilson,R.K., Higginbotham,J., Marchetto,P. and Ochoa,K. The sequence of Zea mays bac clone ZMMBBb-125N17.
Protein ref. UniProtKB:   B6TM55
DNA ref. GenBank:   AC202833.3 (78616..81860)
mRNA ref. GenBank:   EU966070
Cluster/Prediction ref. UniGene:   Zm.20035
Protein sequence: ZmAPx05(Zm00001d047757 / GRMZM2G054300 [6a] / APx1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27219.78  
PI (pH):   %s   5.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKNYPTVSAEYSEAVEKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSSRTGGPFGTMKCPAELAHGANAGLDIAVRLLEPIKEEFPTLSYADFYLAGVVAVEVTGGPEIPFHPGRED
KPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTGRCHKERSGFEGAWTTNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPVFRPLVEKYADEKAFFDDYKEAHLKLS
ELGYADA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, 8 introns), 1 mRNA and 460 ESTs. ALso found in AC220062.3. Incorrect prediction from Phytozome (splicing error).
DNA ►
Send to BLAST
CDS►
Send to BLAST