1. Browse the Database
  2. View Redoxidase
Entry information : GmAPx-R[P]-R (Glyma04g07090 / GmAPx[P]-R)
Entry ID 7454
Creation 2010-08-05 (Christophe Dunand)
Last sequence changes 2011-12-14 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2015-03-23 (Christophe Dunand)
Peroxidase information: GmAPx-R[P]-R (Glyma04g07090 / GmAPx[P]-R)
Name (synonym) GmAPx-R[P]-R (Glyma04g07090 / GmAPx[P]-R)
Class Ascorbate peroxidase related     [Orthogroup: APx-R001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx-R[P]-R
start..stop		 S start..stop
GmAPx-R 383 5.03e-136 1..220 82..314
LjAPx-R 342 1.01e-119 1..220 80..312
MtAPx-R 340 6.49e-119 2..220 84..315
VvAPx-R 317 1.49e-109 3..220 95..325
Gene structure Fichier Exons►


exon

Literature and cross-references GmAPx-R[P]-R (Glyma04g07090 / GmAPx[P]-R)
DNA ref. Phytozome 12:   Gm04 (5505338..5508206)
Protein sequence: GmAPx-R[P]-R (Glyma04g07090 / GmAPx[P]-R)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   229
PWM (Da):   %s   24741.86  
PI (pH):   %s   5.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RPGTKEYLLIKEEVRKVLSKGKAAGVLRLVFLDAGTFDIDDSTGIILLVLQQAKTQIDVIQPNILLSVSWADMNIAVAGAEAVEVCGGPPIQVSPGRLDTLVHDPEGRLPEESLNASGLK
KCFQSKGFLTQELVALSGAHTIGSKGFGSSISFENSYYKVLLEKPWTSGGMSSMIGLPSDHALVEDDECLRWIKKYADSENLFFEDFKNAYVKLVNSGVGGIAYKFR

Retrieve as FASTA  
Remarks Pseudogene from genomic (chromo 4). 2 first exons, fragments (xxx) and stop codon are missing. ORF predicted by Phytozome. No EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST